Cat: PA2000-6835

Recombinant Human COX6B2 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    COX6B2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    COX6B2Cytochrome c oxidase subunit 6B2; Cancer/testis antigen 59; CT59; Cytochrome c oxidase subunit VIb isoform 2; COX VIb-2; Cytochrome c oxidase subunit VIb; testis-specific isoform

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q6YFQ2

  • Expression Region

    1-88aa

  • AA Sequence

    MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPISWVESWNEQIKNGIFAGKI

  • Molecular Weight

    36.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

COX6B2, a crucial subunit of the cytochrome c oxidase (COX) complex, plays an essential role in mitochondrial respiratory function and cellular energy metabolism. This protein is integral to the electron transport chain, facilitating ATP production through oxidative phosphorylation. Dysregulation or mutations in COX6B2 can lead to mitochondrial dysfunction, which has been implicated in various neurodegenerative diseases and metabolic disorders. Recent research has focused on the structural and functional characterization of COX6B2, revealing its significance in maintaining COX stability and activity. Notably, studies have shown that alterations in COX6B2 expression levels can influence mitochondrial dynamics, bioenergetics, and apoptotic pathways. Given its vital role in energy metabolism, COX6B2 represents a potential therapeutic target for restoring mitochondrial function in disease contexts. As a result, researchers are increasingly investigating the biochemical properties and regulatory mechanisms of COX6B2, aiming to uncover novel insights into its role in health and disease. Understanding the complete functional landscape of COX6B2 is pivotal for developing strategies to mitigate the impact of mitochondrial-related diseases and enhancing overall cellular viability.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US