Analytical Data
-
Gene name
COX6B2
- Application
-
Alternative Names
COX6B2Cytochrome c oxidase subunit 6B2; Cancer/testis antigen 59; CT59; Cytochrome c oxidase subunit VIb isoform 2; COX VIb-2; Cytochrome c oxidase subunit VIb; testis-specific isoform
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6YFQ2
-
Expression Region
1-88aa
-
AA Sequence
MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPISWVESWNEQIKNGIFAGKI
-
Molecular Weight
36.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COX6B2, a crucial subunit of the cytochrome c oxidase (COX) complex, plays an essential role in mitochondrial respiratory function and cellular energy metabolism. This protein is integral to the electron transport chain, facilitating ATP production through oxidative phosphorylation. Dysregulation or mutations in COX6B2 can lead to mitochondrial dysfunction, which has been implicated in various neurodegenerative diseases and metabolic disorders. Recent research has focused on the structural and functional characterization of COX6B2, revealing its significance in maintaining COX stability and activity. Notably, studies have shown that alterations in COX6B2 expression levels can influence mitochondrial dynamics, bioenergetics, and apoptotic pathways. Given its vital role in energy metabolism, COX6B2 represents a potential therapeutic target for restoring mitochondrial function in disease contexts. As a result, researchers are increasingly investigating the biochemical properties and regulatory mechanisms of COX6B2, aiming to uncover novel insights into its role in health and disease. Understanding the complete functional landscape of COX6B2 is pivotal for developing strategies to mitigate the impact of mitochondrial-related diseases and enhancing overall cellular viability.
