Analytical Data
-
Gene name
IFNGR1
- Application
-
Alternative Names
IFNGR1；Interferon gamma receptor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15260
-
Expression Region
18-245aa
-
AA Sequence
EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYG VKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSE EFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTC YIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSA EGVLHVWGVTTEKSKEVCITIFNSSIKG
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of the recombinant protein IFNGR1 (Interferon Gamma Receptor 1) has gained significant attention due to its crucial role in the immune response, particularly in the signaling pathways activated by interferon-gamma (IFN-γ). IFNGR1 is part of a receptor complex that facilitates the immune system's response to viral infections and intracellular pathogens. Mutations or deficiencies in the IFNGR1 gene can lead to severe immunodeficiencies, making individuals particularly susceptible to infections, including mycobacterial diseases. Due to its importance in immune regulation, researchers are investigating the structure and function of IFNGR1 through recombinant protein techniques. This includes the expression, purification, and functional analysis of IFNGR1, which can provide insights into its signaling mechanisms and interactions with other proteins. Moreover, understanding the molecular basis of its function can lead to potential therapeutic strategies for treating infections and enhancing immune responses. The development of recombinant IFNGR1 also opens avenues for vaccine research, as this protein may serve as a target for immunomodulation. Overall, the exploration of IFNGR1 as a recombinant protein contributes significantly to our understanding of host-pathogen interactions and the immune response, highlighting its potential implications in clinical and therapeutic contexts.
