Cat: PA1000-7517

Recombinant Human TNFRSF10D Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TNFRSF10D

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TNFRSF10D;DCR2;TRAILR4;TRUNDD;Tumor necrosis factor receptor superfamily member 10D

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UBN6

  • Expression Region

    56-211aa

  • AA Sequence

    ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDY TIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMC RTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGM LASPYHVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPE VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTV LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH

  • Molecular Weight

    44 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TNFRSF10D, also known as Decoy Receptor 3 (Dcr3), is a member of the tumor necrosis factor receptor superfamily and plays a pivotal role in modulating immune responses and promoting cell survival. This protein is primarily known for its ability to bind to ligands of the TNF superfamily, such as TRAIL (TNF-related apoptosis-inducing ligand), thereby inhibiting apoptosis in various cell types. Its significance has been underscored in the context of several diseases, including autoimmune disorders and cancers. Research has demonstrated that TNFRSF10D can regulate the tumor microenvironment, supporting cancer cell proliferation by neutralizing pro-apoptotic signals. Consequently, recombinant TNFRSF10D proteins have become valuable tools for studying its biological functions, therapeutic applications, and potential as a biomarker for disease progression. In addition, understanding its interaction with other signaling pathways could inform novel therapeutic strategies aimed at enhancing immune responses against tumors or alleviating inflammation in chronic diseases. Thus, the recombinant production and characterization of TNFRSF10D not only contribute to basic research but also hold promise for clinical applications, providing insights into the development of targeted therapies and improving patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US