Analytical Data
-
Gene name
COX17
- Application
-
Alternative Names
COX 17; COX17; COX17 cytochrome c oxidase assembly homolog (S. cerevisiae); COX17 cytochrome c oxidase assembly homolog; COX17 homolog cytochrome c oxidase assembly protein; COX17_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14061
-
Expression Region
1-63aa
-
AA Sequence
MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI
-
Molecular Weight
33.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COX17 is a crucial protein involved in the assembly and maturation of cytochrome c oxidase (CcO), a key component of the mitochondrial respiratory chain responsible for ATP production. The study of COX17 has gained significant attention due to its role in cellular energy metabolism and mitochondrial function, with implications in various diseases, including neurodegenerative disorders and metabolic syndromes. COX17 is known to function as a copper chaperone, facilitating the delivery of copper ions necessary for the enzymatic activity of CcO. Research has highlighted the importance of COX17 in the biogenesis of this enzyme complex, emphasizing the intricate relationship between metal ion homeostasis and mitochondrial health. Furthermore, mutations in the gene encoding COX17 have been associated with certain mitochondrial diseases, making it a potential target for therapeutic intervention. To better understand the biochemical properties and functional mechanisms of COX17, recombinant protein studies have been employed, allowing for detailed characterization of its structure and interactions. These studies provide critical insights into the biological significance of COX17 and open avenues for future research aimed at unraveling the complexities of mitochondrial biology and its effects on human health.
