Analytical Data
-
Gene name
ILDR2
- Application
-
Alternative Names
ILDR2；C1orf32；Immunoglobulin-like domain-containing receptor 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q71H61
-
Expression Region
1-186aa
-
AA Sequence
MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPE
-
Molecular Weight
23.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ILDR2, or Immunoglobulin-like Domain-containing Receptor 2, is a type of protein that has garnered interest in immunology and related fields due to its potential role in modulating immune responses. Research on ILDR2 has suggested its involvement in various biological processes, such as immune regulation, cell signaling, and even in the pathogenesis of certain diseases. Understanding ILDR2's structure and function is critical, especially because its ligand interactions and downstream signaling pathways may offer insights into therapies for autoimmune diseases and cancer. Recent studies have aimed to explore the recombinant expression of ILDR2, focusing on the protein's production, purification, and functional assays. This research not only aids in elucidating how ILDR2 operates within the immune system but also examines its potential as a biomarker or therapeutic target. The expression of ILDR2 as a recombinant protein allows for detailed studies of its characteristics and biological significance, paving the way for future applications in therapeutic development and disease management.
