Analytical Data
-
Gene name
COQ4
- Application
-
Alternative Names
Ubiquinone biosynthesis protein COQ4 homolog. mitochondrial. 4-hydroxy-3-methoxy-5-polyprenylbenzoate decarboxylase. EC:4.1.1.-. Coenzyme Q biosynthesis protein 4 homolog
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y3A0
-
Expression Region
1-265aa
-
AA Sequence
MATLLRPVLRRLCGLPGLQRPAAEMPLRARSDGAGPLYSHHLPTSPLQKALLAAGSAAMALYNPYRHDMVAVLGETTGHRTLKVLRDQMRRDPEGAQILQERPRISTSTLDLGKLQSLPEGSLGREYLRFLDVNRVSPDTRAPTRFVDDEELAYVIQRYREVHDMLHTLLGMPTNILGEIVVKWFEAVQTGLPMCILGAFFGPIRLGAQSLQVLVSELIPWAVQNGRRAPCVLNLYYERRWEQSLRALREELGITAPPMHVQGLA
-
Molecular Weight
56.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Coenzyme Q (CoQ) is an essential component of the electron transport chain, playing a critical role in cellular respiration and energy production. Among the various forms of CoQ, CoQ4 has garnered attention due to its involvement in various biological processes and potential implications in health and disease. Recent studies suggest that COQ4, a gene encoding a key enzyme in the biosynthesis of CoQ, is vital for proper mitochondrial function and could be linked to conditions such as neurodegenerative diseases and aging-related disorders. Given its importance, researchers have focused on the recombinant expression of COQ4 protein to better understand its structure, function, and interactions within the cell. By producing COQ4 in a recombinant system, scientists are able to study its enzymatic activity and character its role in CoQ biosynthesis. This research not only enhances the understanding of mitochondrial biology but also opens avenues for developing therapeutic strategies aimed at targeting mitochondrial dysfunction, which is increasingly recognized as a hallmark of various pathologies. As the field of mitochondrial research advances, the characterization of COQ4 and its recombinant protein forms will be crucial for uncovering the complexities of CoQ metabolism and its broader implications for health.
