Analytical Data
-
Gene name
IFITM3
- Application
-
Alternative Names
IFITM3;Interferon-induced transmembrane Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q01628
-
Expression Region
1-133aa
-
AA Sequence
MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRS ETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYA STAKCLNIWALILGILMTILLIVIPVLIFQAYG
-
Molecular Weight
43 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IFITM3 (Interferon-Induced Transmembrane Protein 3) is a pivotal component of the host's antiviral defense mechanism, known for its role in inhibiting viral entry into cells. Research into IFITM3 has intensified due to its implications in various viral infections, particularly influenza, HIV, and coronaviruses. This protein is induced by interferons, which are key players in the immune response, demonstrating its significance in innate immunity. Studies have shown that IFITM3 restricts viral infection by interfering with the fusion process of viruses with cellular membranes, thereby preventing their replication. Moreover, genetic variations in the IFITM3 gene have been linked to differential susceptibility to infections and varying disease outcomes, which underscores its role in personalized medicine. The recombinant expression of IFITM3 protein in laboratory settings has provided insights into its structure-function relationship and mechanistic actions, fostering the development of therapeutic strategies targeting these pathways. Overall, ongoing research aims to elucidate the full spectrum of IFITM3's antiviral properties, its interactions with other cellular factors, and its potential as a target for therapeutic interventions against viral diseases.











