Cat: PAX2000-11316

Recombinant Human SIVA Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SIVA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Apoptosis regulatory protein Siva. CD27-binding protein. CD27BP

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O15304

  • Expression Region

    1-110 aa

  • AA Sequence

    MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRPVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET

  • Molecular Weight

    37.84 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SIVA (Siva Interacting Protein) is a member of the SIVA family of proteins that has gained attention in the field of molecular biology and immunology due to its significant role in apoptosis and T-cell regulation. Originally identified as a protein that interacts with the 3' end of the CD27 mRNA, SIVA is involved in the mediation of programmed cell death in lymphocytes, influencing immune responses and tolerance. Recent studies have highlighted that SIVA's dysregulation can contribute to various autoimmune diseases and cancers, making it a potential therapeutic target. Researchers have been increasingly focused on the structural and functional aspects of SIVA, particularly its protein-protein interactions and signaling pathways. The recombinant production of SIVA protein has enabled detailed biochemical studies, facilitating the exploration of its role in cellular mechanisms. By employing advanced techniques such as CRISPR and various in vitro assays, scientists aim to understand how SIVA modulates T-cell fate and its implications in immune system disorders. These efforts are essential for harnessing SIVA in the development of novel immunotherapeutic strategies and improving our understanding of its physiological functions in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US