Analytical Data
-
Gene name
SIVA
- Application
-
Alternative Names
Apoptosis regulatory protein Siva. CD27-binding protein. CD27BP
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15304
-
Expression Region
1-110 aa
-
AA Sequence
MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRPVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET
-
Molecular Weight
37.84 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SIVA (Siva Interacting Protein) is a member of the SIVA family of proteins that has gained attention in the field of molecular biology and immunology due to its significant role in apoptosis and T-cell regulation. Originally identified as a protein that interacts with the 3' end of the CD27 mRNA, SIVA is involved in the mediation of programmed cell death in lymphocytes, influencing immune responses and tolerance. Recent studies have highlighted that SIVA's dysregulation can contribute to various autoimmune diseases and cancers, making it a potential therapeutic target. Researchers have been increasingly focused on the structural and functional aspects of SIVA, particularly its protein-protein interactions and signaling pathways. The recombinant production of SIVA protein has enabled detailed biochemical studies, facilitating the exploration of its role in cellular mechanisms. By employing advanced techniques such as CRISPR and various in vitro assays, scientists aim to understand how SIVA modulates T-cell fate and its implications in immune system disorders. These efforts are essential for harnessing SIVA in the development of novel immunotherapeutic strategies and improving our understanding of its physiological functions in health and disease.
