Analytical Data
-
Gene name
LYZL1
- Application
-
Alternative Names
LYZL1；LYC2；Lysozyme-like Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UWQ5
-
Expression Region
1-194aa
-
AA Sequence
MQDAPLSCLSPTKWSSVSSADSTEKSASGAGTRNLPFQFCLRQALRMKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEGRDLSEWKKGCEVS
-
Molecular Weight
37.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LYZL1 (lysozyme-like protein 1) is a gene that encodes a protein belonging to the lysozyme family, which is known for its antimicrobial properties. Initially identified in human testis, LYZL1 is believed to play a crucial role in male reproductive health, particularly in sperm maturation and protection against pathogens. Research has shown that LYZL1 is highly expressed in the male reproductive system, suggesting its involvement in fertility processes. However, despite its significance, the exact functions and mechanisms of LYZL1 remain poorly understood. Recent studies have highlighted its potential role in sperm motility and interaction with the female reproductive tract, implicating it as a key factor in successful fertilization. Additionally, investigating the structure and biochemical properties of the LYZL1 recombinant protein could provide valuable insights into its functional roles and therapeutic potential. Overall, exploring LYZL1, particularly through recombinant protein studies, may lead to advancements in reproductive health treatments and fertility therapies, addressing both male infertility and broader implications in human health.
