Cat: PA1000-7481

Recombinant Human CDKL2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CDKL2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CDKL2;Cyclin-dependent kinase-like 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q92772

  • Expression Region

    1-493aa

  • AA Sequence

    MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMR EIKLLKQLRHENLVNLLEVCKKKKRWYLVFEFVDHTILDDLELFPNGLDY QVVQKYLFQIINGIGFCHSHNIIHRDIKPENILVSQSGVVKLCDFGFART LAAPGEVYTDYVATRWYRAPELLVGDVKYGKAVDVWAIGCLVTEMFMGEP LFPGDSDIDQLYHIMMCLGNLIPRHQELFNKNPVFAGVRLPEIKEREPLE RRYPKLSEVVIDLAKKCLHIDPDKRPFCAELLHHDFFQMDGFAERFSQEL QLKVQKDARNVSLSKKSQNRKKEKEKDDSLVEERKTLVVQDTNADPKIKD YKLFKIKGSKIDGEKAEKGNRASNASCLHDSRTSHNKIVPSTSLKDCSNV SVDHTRNPSVAIPPLTHNLSAVAPSINSGMGTETIPIQGYRVDEKTKKCS IPFVKPNRHSPSGIYNINVTTLVSGPPLSDDSGADLPQMEHQH

  • Molecular Weight

    81 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CDKL2 (Cyclin-Dependent Kinase-Like 2) is a serine/threonine kinase that plays a crucial role in various cellular processes, including cell cycle regulation, neuronal differentiation, and signal transduction. The gene encoding CDKL2 is located on human chromosome X and is primarily expressed in the brain, suggesting its significant involvement in neurological functions. Recent studies have linked mutations in the CDKL2 gene to neurodevelopmental disorders, including intellectual disabilities and autism spectrum disorders, indicating that understanding its biological functions and molecular mechanisms is vital for potential therapeutic interventions. The recombinant protein of CDKL2 is utilized in various research applications to elucidate its enzymatic activity, substrate specificity, and interaction with other cellular proteins. By producing and characterizing CDKL2 recombinant protein, researchers aim to uncover its roles in cell signaling pathways and how its dysregulation might contribute to neurodevelopmental diseases. Furthermore, studying CDKL2 can provide insights into the broader mechanisms governing neuronal development and function, thereby offering potential targets for drug discovery and treatment strategies for related disorders. This research is essential for advancing our understanding of brain development and the pathophysiology of associated conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US