Analytical Data
-
Gene name
NCU05495
- Application
-
Alternative Names
NCU05495；
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7S6U4
-
Expression Region
1-111aa
-
AA Sequence
MSFHVTAEDARIEVRDNRTILFARLRREDGEWNDASYELDQIIGNNDGHFQWGGQNFTETAEDIRFHPKEGAAEQPILRARLRDCNGEFHDRDVNLTEIVENVNGEFQAKF
-
Molecular Weight
16.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NCU05495 is a recombinant protein derived from the fungal pathogen Neurospora crassa, which has garnered interest due to its potential applications in biotechnology and medicine. Research into NCU05495 focuses on its role in fungal biology, particularly in the context of pathogenicity and the molecular mechanisms underlying fungal infections. As an organism that serves as a model system, Neurospora crassa allows scientists to explore the genetic and biochemical pathways involved in fungal growth and development. The recombinant form of NCU05495 offers insights into its structure-function relationships, facilitating investigations into its enzymatic activities and interactions with host systems. Understanding the properties of NCU05495 can lead to the discovery of novel antifungal targets, providing a basis for developing new therapeutic strategies to combat fungal diseases. Furthermore, the study of this protein can enhance our comprehension of fungal biology and ecology, thus contributing to advances in agricultural biocontrol and the management of fungal pathogens. The ongoing research into NCU05495 emphasizes its significance not only in basic science but also in applied fields, highlighting the protein's potential as a valuable tool in addressing public health challenges posed by pathogenic fungi.
