Analytical Data
-
Gene name
ATG8
- Application
-
Alternative Names
ATG8；apg8；Autophagy-related Protein 8
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H0R8
-
Expression Region
1-117aa
-
AA Sequence
MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYG
-
Molecular Weight
40.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ATG8, a key protein in the autophagy pathway, plays a vital role in cellular degradation and recycling processes. Autophagy, derived from the Greek words "auto" meaning self and "phagy" meaning eating, is essential for maintaining cellular homeostasis by removing damaged organelles, misfolded proteins, and invading pathogens. ATG8 is a ubiquitin-like protein that can be conjugated to phosphatidylethanolamine, a lipid found in cellular membranes, thus facilitating the formation of autophagosomes—double-membraned vesicles crucial for the autophagic process. The study of ATG8 and its homologs, such as LC3 in mammals, has garnered considerable attention due to their implications in various diseases, including cancer, neurodegeneration, and infections. Researchers are exploring the structural and functional aspects of ATG8 to develop therapeutic strategies that modulate autophagy. The ability to manipulate ATG8 activity could offer novel approaches for treating diseases characterized by either excessive or insufficient autophagic activity. Overall, the ongoing research on ATG8 recombinants aims to expand our understanding of autophagy and its intricate role in health and disease.
