Analytical Data
-
Gene name
MAP2K6
- Application
-
Alternative Names
MAP2K6;MEK6;MKK6;PRKMK6;Dual specificity mitogen-activated Protein kinase kinase 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P52564
-
Expression Region
1-334aa
-
AA Sequence
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKA DDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDL DISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTI PEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGI SGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIEL AILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSK ERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAP2K6, also known as Mitogen-Activated Protein Kinase Kinase 6, is a critical component of the MAPK signaling pathway, which plays a vital role in various cellular processes such as proliferation, differentiation, and apoptosis. Research on MAP2K6 has garnered significant attention due to its involvement in inflammatory responses and neurological disorders. Elevated expression levels of MAP2K6 have been observed in several types of cancer, suggesting that it may function as an oncoprotein. Additionally, MAP2K6 activation influences several downstream targets, including p38 MAPK, which is implicated in stress responses and inflammatory signaling. The generation of recombinant MAP2K6 proteins serves as a valuable tool for elucidating its regulatory mechanisms and interactions within the MAPK cascade. By facilitating structural and functional analyses, the recombinant protein allows researchers to dissect how MAP2K6 modulates cellular responses and contributes to disease pathogenesis. Furthermore, understanding the biochemical properties and functional roles of MAP2K6 may open new avenues for therapeutic interventions targeting its pathways in cancer, inflammation, and neurodegeneration. Therefore, the study of recombinant MAP2K6 protein not only enhances our comprehension of its biological significance but also paves the way for developing targeted therapies in related diseases.











