Analytical Data
-
Gene name
COMTD1
- Application
-
Alternative Names
COMTD1; UNQ766/PRO1558; Catechol O-methyltransferase domain-containing protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86VU5
-
Expression Region
1-262aa
-
AA Sequence
MTQPVPRLSVPAALALGSAALGAAFATGLFLGRRCPPWRGRREQCLLPPEDSRLWQYLLSRSMREHPALRSLRLLTLEQPQGDSMMTCEQAQLLANLARLIQAKKALDLGTFTGYSALALALALPADGRVVTCEVDAQPPELGRPLWRQAEAEHKIDLRLKPALETLDELLAAGEAGTFDVAVVDADKENCSAYYERCLQLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLLPLGDGLTLAFKI
-
Molecular Weight
55.2 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COMTD1 (Carboxy-Terminal Modulator of the Doxorubicin Resistance 1) is a relatively novel protein that has garnered attention in the field of cancer research, particularly concerning its role in drug resistance. Initial studies indicated that COMTD1 may play a crucial role in modulating responses to chemotherapeutic agents, particularly doxorubicin, a commonly used medication in breast cancer treatment. As cancer cells often develop resistance to chemotherapy, understanding the mechanisms underlying this process is vital for improving treatment efficacy. Research has suggested that COMTD1 influences cellular pathways related to drug transport and metabolism, thereby affecting the accumulation of doxorubicin within tumor cells. The exploration of COMTD1's function may uncover new therapeutic targets and strategies for overcoming resistance, ultimately enhancing treatment outcomes for cancer patients. Given the increasing prevalence of multidrug resistance in various cancers, further investigation into COMTD1's structural characteristics and interaction with other proteins could provide valuable insights into its potential as a biomarker for resistance and a target for novel treatment approaches. As such, the ongoing research into COMTD1 may have significant implications for developing more effective cancer therapies and improving overall patient survival rates.
