Analytical Data
-
Gene name
COMMD8
- Application
-
Alternative Names
COMMD8; MDS022; COMM domain-containing protein 8
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NX08
-
Expression Region
1-183aa
-
AA Sequence
MEPEEGTPLWRLQKLPAELGPQLLHKIIDGICGRAYPVYQDYHTVWESEEWMHVLEDIAKFFKAIVGKNLPDEEIFQQLNQLNSLHQETIMKCVKSRKDEIKQALSREIVAISSAQLQDFDWQVKLALSSDKIAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQLK
-
Molecular Weight
47.5 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COMMD8, a member of the COMMD (COMM domain-containing) protein family, has garnered interest in recent years due to its potential roles in cellular processes such as protein trafficking, transcriptional regulation, and maintaining cellular homeostasis. The COMMD family is characterized by the presence of a COMM domain, which facilitates interactions with a variety of proteins, suggesting a diverse range of biological functions. Initial studies have indicated that COMMD8 may be involved in the regulation of copper metabolism and the modulation of NF-κB signaling pathways, both of which are critical in the context of various diseases, including cancer and inflammatory disorders. Furthermore, COMMD8 has been linked to the cellular response to oxidative stress, making it a significant player in the study of cellular survival and apoptosis. Exploring the recombinant protein of COMMD8 can provide insights into its structural and functional properties, allowing for a deeper understanding of its mechanisms of action. This research could potentially lead to novel therapeutic strategies targeting diseases associated with dysregulated COMMD8 activity, highlighting its importance as a biomarker or therapeutic target in conditions such as neurodegenerative diseases and cancer. Overall, the study of COMMD8 recombinant protein is crucial for unraveling its biological significance and therapeutic potential in disease contexts.
