Analytical Data
-
Gene name
SHANK2
- Application
-
Alternative Names
SHANK2; CORTBP1; KIAA1022; PROSAP1; SH3 and multiple ankyrin repeat domains protein 2; Shank2; Cortactin-binding protein 1; CortBP1; Proline-rich synapse-associated protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UPX8
-
Expression Region
1034-1124 aa
-
AA Sequence
SILQQMNREKLAKPGEGLDSPMGAKSASLAPRSPEIMSTISGTRSTTVTFTVRPGTSQPITLQSRPPDYESRTSGTRRAPSPVVSPTEMNK
-
Molecular Weight
35.75 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SHANK2 (SH3 and Multiple Ankyrin Repeat Domains 2) is a member of the SHANK family of proteins, which play a crucial role in the organization and function of postsynaptic complexes in neurons. These proteins are integral to synaptic signaling and are involved in various neurodevelopmental processes. Mutations or disruptions in SHANK2 have been linked to several neuropsychiatric disorders, including autism spectrum disorders (ASD) and schizophrenia, making it a significant focus in research aimed at understanding the molecular underpinnings of these conditions. The study of SHANK2 recombinant proteins allows researchers to investigate the structural and functional properties of SHANK2 in a controlled environment, shedding light on how specific mutations affect protein interactions and synaptic function. Furthermore, recombinant SHANK2 proteins can serve as valuable tools for developing potential therapeutic strategies aimed at correcting the synaptic deficits associated with SHANK2-related disorders. By elucidating the role of SHANK2 in synaptic architecture and neurotransmission, researchers hope to pave the way for novel interventions that could alleviate symptoms in affected individuals, thus highlighting the importance of this protein in both basic neuroscience and translational research.
