Analytical Data
-
Gene name
Klra3
- Application
-
Alternative Names
Klra3;Ly-49c;Ly49C;Killer cell lectin-like receptor 3
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q64329
-
Expression Region
70-266aa
-
AA Sequence
QYNQHKQEINETLNHHHNCSNMQRAFNLKEEMLTNKSIDCRPSNETLEYIKREQDRWDSKTKTVLDSSRDTGRGVKYWFCYSTKCYYFIMNKTTWSGCKANCQHYSVPILKIEDEDELKFLQRHVIPENYWIGLSYDKKKKEWAWIDNGPSKLDMKIRKMNFKSRGCVFLSKARIEDIDCNIPYYCICGKKLDKFPD
-
Molecular Weight
27.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Klra3, also known as KLRD1 or CD94, is a key member of the C-type lectin-like receptor family and plays a significant role in the immune response, particularly in the recognition of stressed or infected cells by natural killer (NK) cells and some T cells. The study of Klra3 recombinant protein is crucial for understanding its structural and functional properties, which are pivotal in immune regulation and response. Researchers have focused on the characterization of Klra3 due to its involvement in various diseases, including cancer and autoimmune disorders, where its expression can be altered. The recombinant protein allows for detailed studies of its interaction with other molecules, such as HLA-E and other ligands, which are essential for NK cell activation and signaling. Furthermore, Klra3's potential as a therapeutic target is under investigation, as modulating its activity could enhance anti-tumor immunity or correct aberrant immune responses. Establishing effective recombinant production systems for Klra3 not only facilitates the exploration of its biological functions but also advances the development of immunotherapeutic strategies. Understanding the dynamics of Klra3 interactions and its signaling pathways can reveal insights into its role in health and disease, ultimately contributing to the development of innovative treatments aimed at harnessing or reprogramming the immune system. Research in this area remains critical, as elucidating Klra3's mechanisms may lead to breakthroughs in immunotherapy and a better understanding of immune evasion by tumors.











