Cat: PA2000-3140

Recombinant Mouse Klra3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Klra3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Klra3;Ly-49c;Ly49C;Killer cell lectin-like receptor 3

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q64329

  • Expression Region

    70-266aa

  • AA Sequence

    QYNQHKQEINETLNHHHNCSNMQRAFNLKEEMLTNKSIDCRPSNETLEYIKREQDRWDSKTKTVLDSSRDTGRGVKYWFCYSTKCYYFIMNKTTWSGCKANCQHYSVPILKIEDEDELKFLQRHVIPENYWIGLSYDKKKKEWAWIDNGPSKLDMKIRKMNFKSRGCVFLSKARIEDIDCNIPYYCICGKKLDKFPD

  • Molecular Weight

    27.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Klra3, also known as KLRD1 or CD94, is a key member of the C-type lectin-like receptor family and plays a significant role in the immune response, particularly in the recognition of stressed or infected cells by natural killer (NK) cells and some T cells. The study of Klra3 recombinant protein is crucial for understanding its structural and functional properties, which are pivotal in immune regulation and response. Researchers have focused on the characterization of Klra3 due to its involvement in various diseases, including cancer and autoimmune disorders, where its expression can be altered. The recombinant protein allows for detailed studies of its interaction with other molecules, such as HLA-E and other ligands, which are essential for NK cell activation and signaling. Furthermore, Klra3's potential as a therapeutic target is under investigation, as modulating its activity could enhance anti-tumor immunity or correct aberrant immune responses. Establishing effective recombinant production systems for Klra3 not only facilitates the exploration of its biological functions but also advances the development of immunotherapeutic strategies. Understanding the dynamics of Klra3 interactions and its signaling pathways can reveal insights into its role in health and disease, ultimately contributing to the development of innovative treatments aimed at harnessing or reprogramming the immune system. Research in this area remains critical, as elucidating Klra3's mechanisms may lead to breakthroughs in immunotherapy and a better understanding of immune evasion by tumors.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US