Analytical Data
-
Gene name
COG8
- Application
-
Alternative Names
COG8; Conserved oligomeric Golgi complex subunit 8; COG complex subunit 8; Component of oligomeric Golgi complex 8
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96MW5
-
Expression Region
1-219aa
-
AA Sequence
MNSYMLISAPAILGTSNMPAAVPATQPGTLQPPMVLLDFPPLACFLNNILVAFNDLRLCCPVALAQDVTGALEDALAKVTKIILAFHRAEEAAFSSGEQELFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNLGHVNIGAIQEPLAFILPKRETLFTLDDQALGPELTAPAPEPPAEEPRLEPAGPACPEGGRAETQAEPPSVGP
-
Molecular Weight
49.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COG8, a member of the Conserved Oligomeric Golgi (COG) complex, plays a critical role in maintaining Golgi apparatus integrity and function, which is essential for intracellular transport and glycoprotein processing. Research on COG8 has gained traction due to its involvement in several cellular processes, particularly those related to membrane trafficking and protein glycosylation. Mutations in the COG complex, including COG8, have been linked to congenital disorders, such as COG8 deficiency, resulting in cognitive impairments, developmental delays, and immunological issues, underlining its importance in human health. Understanding COG8's structure and function is crucial for revealing the mechanisms underlying these diseases and may open avenues for targeted therapeutic strategies. Recent advances in protein engineering and cryo-electron microscopy have provided insights into the oligomeric structure and interactions of COG8 within the COG complex, spurring interest in its potential as a biomarker for disease diagnosis and progression. Overall, the study of COG8 not only enhances our understanding of Golgi function but also holds promise for improving clinical outcomes in patients with COG-related disorders.
