Analytical Data
-
Gene name
SH2B
- Application
-
Alternative Names
SH2B adapter protein 1. Pro-rich. PH and SH2 domain-containing signaling mediator. PSM. SH2 domain-containing protein 1B
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NRF2
-
Expression Region
1-426 aa
-
AA Sequence
MVQREELLSFMGAEEAAPDPAGVGRGGGVAGPPSGGGGQPQWQKCRLLLRSEGEGGGGSRLEFFVPPKASRPRLSIPCSSITDVRTTTALEMPDRENTFVVKVEGPSEYIMETVDAQHVKAWVSDIQECLSPGPCPATSPRPMTLPLAPGTSFLTRENTDSLELSCLNHSESLPSQDLLLGPSESNDRLSQGAYGGLSDRPSASISPSSASIAASHFDSMELLPPELPPRIPIEEGPPAGTVHPLSAPYPPLDTPETATGSFLFQGEPEGGEGDQPLSGYPWFHGMLSRLKAAQLALTGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQSIFDMLEHFRVHPIPLESGGSSDVVLVSYVPSSQRQQGREQAGSHAGVCEGDGCHPDASCTLMPFGASDCVTDHLP
-
Molecular Weight
71.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SH2B proteins are a family of adaptor proteins implicated in various cellular signaling pathways, playing critical roles in the regulation of cell growth, differentiation, and metabolism. Their name, SH2B, derives from their structure, which includes Src Homology 2 (SH2) domains that enable them to interact with phosphorylated tyrosine residues on other proteins, facilitating downstream signaling processes. Research on SH2B proteins has gained momentum due to their involvement in crucial biological processes and their association with several diseases, including cancer, obesity, and insulin resistance. Notably, SH2B1 has been shown to modulate insulin signaling and is thought to influence glucose homeostasis. Additionally, SH2B family members have been implicated in the pathways of various growth factor receptors and cytokines, highlighting their diverse roles in the immune response and neurobiology. Given their multifunctional nature, SH2B proteins serve as potential therapeutic targets for modulating signaling pathways in diseases linked to metabolic disorders and cancer. Understanding the biochemical mechanisms underlying SH2B protein interactions and functions is an active area of research, with the goal of elucidating their roles in health and disease, which could pave the way for novel treatment strategies.
