Analytical Data
-
Gene name
PDE4DIP
- Application
-
Alternative Names
PDE4DIP;CMYA2;KIAA0454;KIAA0477;Myomegalin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5VU43
-
Expression Region
1-310aa
-
AA Sequence
MKGTDSGSCCRRRCDFGCCCRASRRAHYTPYRSGDATRTPQSPRQTPSRERRRPEPAGSWAAAAEEEEAAAAATPWMRDYFAEDDGEMVPRTSHTAAFLSDTKDRGPPVQSQIWRSGEKVPFVQTYSLRAFEKPPQVQTQALRDFEKHLNDLKKENFSLKLRIYFLEERMQQKYEASREDIYKRNIELKVEVESLKRELQDKKQHLDKTWADVENLNSQNEAELRRQFEERQQETEHVYELLENKIQLLQEESRLAKNEAARMAALVEAEKECNLELSEKLKGVTKNWEDVPGDQVKPDQYTEALAQRDK
-
Molecular Weight
63.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PDE4DIP, or Phosphodiesterase 4D interacting Protein, is a crucial protein involved in various cellular processes, particularly in neuronal signaling and synaptic regulation. This protein interacts with phosphodiesterase 4D, an enzyme that plays a significant role in the hydrolysis of cyclic adenosine monophosphate (cAMP), a key second messenger in cellular signaling pathways. Dysregulation of cAMP levels is associated with several neurological disorders, including depression and schizophrenia. Understanding the structure and function of PDE4DIP can provide insights into its role in these pathways, potentially leading to the development of therapeutic strategies targeting related diseases. Recent studies have focused on characterizing the biochemical properties of PDE4DIP, examining its molecular interactions, and exploring its implications in synaptic plasticity. The production of recombinant PDE4DIP protein allows researchers to perform detailed functional assays and structural analyses, facilitating the elucidation of its mechanisms of action. This line of research is pivotal not only for gaining a deeper understanding of synaptic function but also for developing interventions that could modulate PDE4DIP activity to restore normal signaling in pathological conditions.











