Analytical Data
-
Gene name
C11orf73
- Application
-
Alternative Names
C11orf73;C11orf73;Protein Hikeshi
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q53FT3
-
Expression Region
1-197aa
-
AA Sequence
MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWKT
-
Molecular Weight
37.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C11orf73, also known as "Chromosome 11 Open Reading Frame 73," is a recently identified gene that has garnered interest due to its potential implications in various cellular processes and diseases. The protein encoded by C11orf73 is thought to be involved in critical biological functions, including cellular metabolism and signal transduction. Research has suggested a link between C11orf73 expression levels and several pathological conditions, including neurodegenerative disorders and cancer. Despite these associations, the precise biological role of C11orf73 remains largely unexplored, primarily due to the limited understanding of its structure and function. As a result, studies focusing on the recombinant expression of C11orf73 protein have gained traction. These studies aim to produce the protein in a laboratory setting, facilitating structural analyses and functional assays. Understanding C11orf73's molecular characteristics can help elucidate its role in health and disease, and potentially lead to the identification of novel therapeutic targets. Consequently, recombinant C11orf73 protein research is a promising avenue for advancing our knowledge of its biological significance and exploring its potential as a biomarker or therapeutic agent.











