Analytical Data
-
Gene name
STAT6
- Application
-
Alternative Names
STAT6；Signal transducer and activator of transcription 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P42226
-
Expression Region
627-837aa
-
AA Sequence
MSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQMPTMVPSYDLGMA PDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQM PPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQ PVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQ PSHYGQSGISMSLEHHHHHH
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
STAT6 (Signal Transducer and Activator of Transcription 6) is a critical transcription factor primarily involved in regulating immune responses, particularly in T helper 2 (Th2) cell differentiation and allergic reactions. Its role in mediating signals from cytokines such as IL-4 and IL-13 has made it a key focus in immunology research, especially regarding asthma and other allergic diseases. Given its central role in modulating gene expression in response to these cytokines, understanding the functions and interactions of STAT6 is crucial for developing targeted therapies. The study of recombinant STAT6 proteins allows researchers to investigate its structural and functional properties in detail, facilitating insights into how specific mutations and variations can affect its activity. Furthermore, recombinant STAT6 can be utilized in various assays to identify potential inhibitors or modulators, leading to novel therapeutic agents for allergic conditions and other diseases where STAT6 is implicated. As research progresses, the exploration of STAT6 as a therapeutic target continues to hold promise in the management of Th2-mediated pathologies, highlighting the necessity of detailed studies focusing on its recombinant forms to elucidate their potential roles in both basic and applied biomedical research.
