Analytical Data
-
Gene name
SPEG
- Application
-
Alternative Names
SPEG；APEG1；KIAA1297；Striated muscle preferentially expressed Protein kinase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15772
-
Expression Region
1-113aa
-
AA Sequence
MQKARGTRGEDAGTRAPPSPGVPPKRAKVGAGGGAPVAVAGAPVFLRPLKNAAVCAGSDVRLRVVVSGTPQPSLRWFRDGQLLPAPAPEPSCLWLRRCGAQDAGVYSCMAQNE
-
Molecular Weight
38.7kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SPEG (Sperm Protein Associated with the Nucleus on the Equatorial Segment) is a protein that plays a crucial role in sperm biology and fertility. It is primarily expressed in the testis and is associated with the acrosome reaction, which is essential for sperm to penetrate the egg during fertilization. Research on SPEG has gained traction due to its potential implications in reproductive health and fertility disorders. Abnormalities in SPEG expression or function have been linked to male infertility, making it a target for studies aiming to understand the mechanisms underlying sperm development and function. Additionally, SPEG is believed to interact with various signaling pathways involved in cell motility and has implications in cellular differentiation processes. Recent advances in molecular biology techniques have allowed researchers to analyze the structure, expression patterns, and functional roles of SPEG more comprehensively, paving the way for potential therapeutic interventions in cases of male infertility. Understanding the full spectrum of SPEG's role in reproductive biology could lead to the development of novel diagnostic tools and treatments for infertility, underscoring the importance of continued research in this area. As the field of reproductive biology evolves, SPEG represents a promising avenue for exploration, with the potential to contribute significantly to our understanding of male reproductive health.
