Cat: PA1000-7339

Recombinant Human SPEG Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SPEG

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SPEG;APEG1;KIAA1297;Striated muscle preferentially expressed Protein kinase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15772

  • Expression Region

    1-113aa

  • AA Sequence

    MQKARGTRGEDAGTRAPPSPGVPPKRAKVGAGGGAPVAVAGAPVFLRPLKNAAVCAGSDVRLRVVVSGTPQPSLRWFRDGQLLPAPAPEPSCLWLRRCGAQDAGVYSCMAQNE

  • Molecular Weight

    38.7kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SPEG (Sperm Protein Associated with the Nucleus on the Equatorial Segment) is a protein that plays a crucial role in sperm biology and fertility. It is primarily expressed in the testis and is associated with the acrosome reaction, which is essential for sperm to penetrate the egg during fertilization. Research on SPEG has gained traction due to its potential implications in reproductive health and fertility disorders. Abnormalities in SPEG expression or function have been linked to male infertility, making it a target for studies aiming to understand the mechanisms underlying sperm development and function. Additionally, SPEG is believed to interact with various signaling pathways involved in cell motility and has implications in cellular differentiation processes. Recent advances in molecular biology techniques have allowed researchers to analyze the structure, expression patterns, and functional roles of SPEG more comprehensively, paving the way for potential therapeutic interventions in cases of male infertility. Understanding the full spectrum of SPEG's role in reproductive biology could lead to the development of novel diagnostic tools and treatments for infertility, underscoring the importance of continued research in this area. As the field of reproductive biology evolves, SPEG represents a promising avenue for exploration, with the potential to contribute significantly to our understanding of male reproductive health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US