Analytical Data
-
Gene name
SFT2D1
- Application
-
Alternative Names
SFT2D1; C6orf83; Vesicle transport protein SFT2A; SFT2 domain-containing protein 1; pRGR1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WV19
-
Expression Region
1-159 aa
-
AA Sequence
MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRLKWFAICFVCGVFFSILGTGLLWLPGGIKLFAVFYTLGNLAALASTCFLMGPVKQLKKMFEATRLLATIVMLLCFIFTLCAALWWHKKGLAVLFCILQFLSMTWYSLSYIPYARDAVIKCCSSLLS
-
Molecular Weight
44.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SFT2D1, a key player in the process of intracellular lipid transport, has garnered significant attention due to its role in lipid metabolism and membrane dynamics. This protein is implicated in various cellular functions, including the transport of lipids to and from cellular compartments, which is critical for maintaining cellular homeostasis. Recent studies have linked dysregulation of SFT2D1 to several metabolic disorders, highlighting its importance in lipid-related diseases. Researchers have recognized the necessity of characterizing the SFT2D1 recombinant protein to better understand its structural and functional properties. The recombinant production of SFT2D1 allows for detailed studies of its interactions, enzymatic activity, and the mechanisms underlying its involvement in lipid trafficking. As SFT2D1 responds to specific cellular signals, understanding its behavior in a controlled environment can provide insights into the physiological and pathological roles of lipid transport mechanisms. Moreover, the production of SFT2D1 as a recombinant protein facilitates the development of potential therapeutic strategies targeting lipid dysregulation, making it a focal point in both basic and applied research in the field of cell biology and metabolism. Overall, the exploration of SFT2D1 through recombinant protein studies represents a promising avenue toward unraveling the complexities of lipid metabolism and its implications in health and disease.
