Cat: PA2000-3119

Recombinant Human dnapkcs Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    dnapkcs

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    dnapkcs;HYRC;HYRC1;DNA-dependent Protein kinase catalytic subunit

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P78527

  • Expression Region

    3746-4128aa

  • AA Sequence

    REHPFLVKGGEDLRQDQRVEQLFQVMNGILAQDSACSQRALQLRTYSVVP MTSRLGLIEWLENTVTLKDLLLNTMSQEEKAAYLSDPRAPPCEYKDWLTK MSGKHDVGAYMLMYKGANRTETVTSFRKRESKVPADLLKRAFVRMSTSPE AFLALRSHFASSHALICISHWILGIGDRHLNNFMVAMETGGVIGIDFGHA FGSATQFLPVPELMPFRLTRQFINLMLPMKETGLMYSIMVHALRAFRSDP GLLTNTMDVFVKEPSFDWKNFEQKMLKKGGSWIQEINVAEKNWYPRQKIC YAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPE SGLSE ETQVKCLMDQATDPNILGRTWEGWEPWM

  • Molecular Weight

    68 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DNA-dependent protein kinase (DNA-PK) is a crucial enzyme involved in the non-homologous end joining (NHEJ) pathway of DNA double-strand break repair. The research on DNA-PK and its recombinant protein has garnered significant attention due to its role in maintaining genomic stability and its implications in cancer biology. DNA-PK consists of a catalytic subunit (DNA-PKcs) and a regulatory component (KU70/KU80 heterodimer), which recognize and bind to broken DNA ends, facilitating the recruitment of additional repair factors. Understanding the structure and function of DNA-PKcs is essential for elucidating the mechanisms of DNA repair and the cellular response to genotoxic stress. Furthermore, aberrations in DNA-PK activity have been linked to various malignancies, making it an attractive target for therapeutic interventions. Recent advancements in recombinant protein technology have enabled the production and purification of DNA-PKcs, allowing researchers to study its biochemical properties, regulatory mechanisms, and interactions with other DNA repair proteins. Insights gained from these studies may lead to the development of novel cancer therapies that enhance the efficacy of radiotherapy and chemotherapy by targeting DNA repair pathways. Thus, the investigation of DNA-PKcs as a recombinant protein is crucial for advancing our understanding of DNA repair mechanisms and providing potential avenues for cancer treatment.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US