Analytical Data
-
Gene name
CKMT1A
- Application
-
Alternative Names
CKMT1A；CKMT；CKMT1B；CKMT；Creatine kinase U-type. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P12532
-
Expression Region
40-417aa
-
AA Sequence
ASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH
-
Molecular Weight
47.1kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CKMT1A, or creatine kinase mitochondrial 1A, is a crucial enzyme that plays a significant role in cellular energy metabolism, particularly within muscle and brain tissues. As a part of the creatine kinase family, CKMT1A facilitates the synthesis and hydrolysis of phosphocreatine, an essential energy buffer that helps maintain ATP levels during periods of high energy demand. Abnormalities in CKMT1A expression or function have been linked to various muscular and neurodegenerative disorders, highlighting its importance in health and disease. Research into the recombinant form of CKMT1A aims to elucidate its biochemical properties, regulatory mechanisms, and potential therapeutic applications. By producing and characterizing recombinant CKMT1A, scientists can investigate its kinetic parameters, structural features, and interactions with other molecules, which may provide insights into its role in pathophysiological conditions. Additionally, recombinant CKMT1A can serve as a valuable tool for developing targeted therapies against diseases where energy metabolism is disrupted. As the understanding of CKMT1A continues to evolve, this enzyme holds promise for advancing treatments for conditions like mitochondrial myopathies and other related disorders.
