Analytical Data
-
Gene name
nosZ
- Application
-
Alternative Names
nosZ；Nitrous-oxide reductase
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q51705
-
Expression Region
58-553aa
-
AA Sequence
ASGDGSVAPGQLDDYYGFWSSGQSGEMRILGIPSMRELMRVPVFNRCSATGWGQTNESVRIHERTMSERTKKFLAANGKRIHDNGDLHHVHMSFTEGKYDGRFLFMNDKANTRVARVRCDVMKCDAILEIPNAKGIHGLRPQKWPRSNYVFCNGEDETPLVNDGTNMEDVANYVNVFTAVDADKWEVAWQVLVSGNLDNCDADYEGKWAFSTSYNSEKGMTLPEMTAAEMDHIVVFNIAEIEKAIAAGDYQELNGVKVVDGRKEASSLFTRYIPIANNPHGCNMAPDKKHLCVAGKLSPTATVLDVTRFDAVFYENADPRSAVVAEPELGLGPLHTAFDGRGNAYTSLFLDSQVVKWNIEDAIRAYAGEKVDPIKDKLDVHYQPGHLKTVMGETLDATNDWLVCLSKFSKDRFLNVGPLKPENDQLIDISGDKMVLVHDGPTFAEPHDAIAVHPSILSDIKSVWDRNDPMWAETRAQAEADGVDIDNWTEEVIRDG
-
Molecular Weight
71.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of the nosZ gene, which encodes for the enzyme nitrous oxide reductase, is vital in understanding the global nitrogen cycle and its implications for climate change. Nitrous oxide (N2O) is a potent greenhouse gas, and its reduction is crucial for mitigating its emissions, primarily produced by agricultural soils and microbial processes. The nosZ gene is primarily found in denitrifying bacteria, which play a significant role in converting nitrate and nitrite into nitrogen gas, subsequently reducing N2O to nitrogen (N2). Research into the nosZ gene has expanded in recent years, focusing on its structure, function, and regulatory mechanisms, as well as the diversity of nosZ-containing organisms in various ecosystems. This research is essential for developing strategies to enhance denitrification processes and reduce N2O emissions, particularly in agriculture. Advances in molecular techniques have enabled the characterization of nosZ sequences and the relationships between different microbial communities and their environmental conditions. Additionally, understanding nosZ's evolutionary history can shed light on how denitrifying pathways have adapted to different ecological niches. In summary, the investigation of nosZ and its associated proteins is critical for comprehending the microbial processes that govern nitrous oxide emissions and for informing practices aimed at reducing greenhouse gases in agricultural systems and natural environments.
