Analytical Data
-
Gene name
CN5H6.4
- Application
-
Alternative Names
CN5H6.4 protein. HCG1993518
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6ICE7
-
Expression Region
1-101aa
-
AA Sequence
MELESTIFRDEDKLFIWGRLWGELCSKQPPGAQGRGLPGWLGHFWVPCPWFCIIHTNHSMLLCSFTRRLGAQKGQGSPHSPVSPASPSSAQGTRQGLRVLG
-
Molecular Weight
37.51 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CN5H6.4 is a recombinant protein that has garnered interest due to its potential applications in various biotechnological and therapeutic fields. This protein, derived from specific genetic sequences, has been studied for its structural and functional properties, which are critical for understanding its role in cellular processes. Research into CN5H6.4 aims to elucidate its biochemical characteristics, including its stability, interaction with other biomolecules, and potential effects on cellular pathways. With advances in protein engineering and expression systems, CN5H6.4 can be produced at scale, allowing for detailed functional assays and characterization. This research is crucial, as it may lead to discoveries in drug development, biomarker identification, and the design of novel therapeutic strategies for various diseases. Additionally, understanding the mechanisms by which CN5H6.4 operates can provide insights into broader biological processes, paving the way for innovative applications in medicine and biotechnology. As studies continue, the importance of CN5H6.4 in both fundamental research and practical applications is becoming increasingly apparent, highlighting the relevance of recombinant proteins in contemporary scientific inquiry.
