Cat: PA2000-6741

Recombinant Human CLN6 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CLN6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CLN6; Ceroid-lipofuscinosis neuronal protein 6; Protein CLN6

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NWW5

  • Expression Region

    1-311aa

  • AA Sequence

    MEATRRRQHLGATGGPGAQLGASFLQARHGSVSADEAARTAPFHLDLWFY FTLQNWVLDFGRPIAMLVFPLEWFPLNKPSVGDYFHMAYNVITPFLLLKL IERSPRTLPRSITYVSIIIFIMGASIHLVGDSVNHRLLFSGYQHHLSVRE NPIIKNLKPETLIDSFELLYYYDEYLGHCMWYIPFFLILFMYFSGCFTAS KAESLIPGPALLLVAPSGLYYWYLVTEGQIFILFIFTFFAMLALVLHQKR KRLFLDSNGLFLFSSFALTLLLVALWVAWLWNDPVLRKKYPGVIYVPEPW AFYTLHVSSRH

  • Molecular Weight

    62.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CLN6 is a protein associated with the neuronal ceroid lipofuscinoses (NCLs), a group of inherited neurodegenerative disorders predominantly affecting children. The CLN6 gene, located on chromosome 15, encodes a protein involved in lysosomal function and cellular homeostasis. Mutations in CLN6 lead to the accumulation of lipofuscins, indicative of lysosomal dysfunction, resulting in progressive neurodegeneration. Understanding the structure and function of CLN6 is crucial for elucidating the pathophysiological mechanisms underlying NCLs, which currently have no effective treatments. Research into recombinant CLN6 protein aims to facilitate the study of its interactions within cellular pathways and potential therapeutic interventions. By producing and characterizing this protein, scientists can explore its role in lysosomal signaling, investigate the effects of specific mutations, and develop targeted strategies to mitigate disease progression. Furthermore, recombinant CLN6 may serve as a valuable tool for high-throughput screening of drug candidates and for studying potential gene therapies. Overall, the investigation of CLN6 recombinant protein is pivotal for advancing our understanding of NCLs and for paving the way toward innovative treatments for affected individuals.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US