Analytical Data
-
Gene name
uPAR
- Application
-
Alternative Names
uPAR；MO3；UPAR；Urokinase plasminogen activator surface receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q03405
-
Expression Region
23-303aa
-
AA Sequence
LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEK TNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGS SDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYL PGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGN STHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHA HLGDAFSMNHIDVSCCTKSGCNHPDLDVQYR
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
uPAR (urokinase plasminogen activator receptor) is a cell surface receptor that plays a crucial role in various physiological and pathological processes, including tissue remodeling, cell migration, and tumor progression. The uPAR system is involved in the regulation of plasminogen activation, which is essential for proteolysis and extracellular matrix degradation. Studies have indicated that uPAR is overexpressed in various cancers and is associated with aggressive tumor behavior, making it a potential biomarker for cancer diagnosis and prognosis. Moreover, uPAR is implicated in inflammatory processes, wound healing, and fibrosis. Research has focused on the structural and functional characterization of uPAR and the development of uPAR-targeted therapies, including antibody-drug conjugates and small molecules that can inhibit its function. The generation of recombinant uPAR proteins has facilitated the study of its interactions and signaling pathways, enabling researchers to explore its role in cellular processes at a molecular level. Understanding the biochemistry and biology of uPAR is critical for developing novel therapeutic strategies aimed at targeting this receptor in cancer and other diseases, ultimately improving patient outcomes through precision medicine approaches.
