Analytical Data
-
Gene name
Slc39a13
- Application
-
Alternative Names
Slc39a13;ZIP13;Zinc transporter ZIP13
-
Species
Rat
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q2M1K6
-
Expression Region
130-233aa
-
AA Sequence
WAYTCNISPGVEGQSLQRQQQLGLWVIAGFLTFLALEKMFLNCKEEDPSQAPSKDPTAAALNGGHCLAQPAAEPGLRAVVRNLKVSGYLNLLANTIDNFTHGLA
-
Molecular Weight
41.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Slc39a13, also known as ZIP13, is a member of the ZIP family of zinc transporter proteins that play crucial roles in zinc homeostasis and transport across cell membranes. This protein is particularly relevant in mammalian physiology due to its involvement in the regulation of zinc levels in various tissues, which is essential for numerous biological processes, including gene expression, enzyme activity, and cellular signaling. Mutations in the Slc39a13 gene have been linked to a range of developmental disorders, such as the rare congenital disorder known as Ehlers-Danlos syndrome, highlighting the significance of this transporter in human health. Research on recombinant Slc39a13 protein is vital for understanding its molecular function and mechanisms of action. By producing and characterizing this protein in vitro, scientists aim to elucidate its role in zinc transport, identify its interaction with other cellular components, and explore its potential implications in disease states. This research could pave the way for designing targeted therapies for conditions associated with dysregulated zinc transport and contribute to the broader understanding of metal ion transport in cellular biology.











