Cat: PA2000-3074

Recombinant Rat Slc39a13 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Slc39a13

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Slc39a13;ZIP13;Zinc transporter ZIP13

  • Species

    Rat

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q2M1K6

  • Expression Region

    130-233aa

  • AA Sequence

    WAYTCNISPGVEGQSLQRQQQLGLWVIAGFLTFLALEKMFLNCKEEDPSQAPSKDPTAAALNGGHCLAQPAAEPGLRAVVRNLKVSGYLNLLANTIDNFTHGLA

  • Molecular Weight

    41.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Slc39a13, also known as ZIP13, is a member of the ZIP family of zinc transporter proteins that play crucial roles in zinc homeostasis and transport across cell membranes. This protein is particularly relevant in mammalian physiology due to its involvement in the regulation of zinc levels in various tissues, which is essential for numerous biological processes, including gene expression, enzyme activity, and cellular signaling. Mutations in the Slc39a13 gene have been linked to a range of developmental disorders, such as the rare congenital disorder known as Ehlers-Danlos syndrome, highlighting the significance of this transporter in human health. Research on recombinant Slc39a13 protein is vital for understanding its molecular function and mechanisms of action. By producing and characterizing this protein in vitro, scientists aim to elucidate its role in zinc transport, identify its interaction with other cellular components, and explore its potential implications in disease states. This research could pave the way for designing targeted therapies for conditions associated with dysregulated zinc transport and contribute to the broader understanding of metal ion transport in cellular biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US