Analytical Data
-
Gene name
SEMA6B
- Application
-
Alternative Names
SEM-SEMA-Y; SEM6B_HUMAN; sema domain; transmembrane domain (TM); and cytoplasmic domain; (semaphorin) 6B; Sema Z; SEMA-VIB; Sema6b; SEMAN; semaphorin VIB; Semaphorin-6B; semaphorin-6Ba; Semaphorin-Z
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H3T3
-
Expression Region
28-126 aa
-
AA Sequence
PEEPPPLSVAPRDYLNHYPVFVGSGPGRLTPAEGADDLNIQRVLRVNRTLFIGDRDNLYRVELEPPTSTELRYQRKLTWRSNPSDINVCRMKGKQEGEC
-
Molecular Weight
36.63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SEMA6B (Semaphorin 6B) is a member of the semaphorin family, which plays crucial roles in axon guidance, neural development, and cell signaling. Emerging evidence suggests that SEMA6B is involved in various biological processes, including neuronal cell interaction and cellular communication during development. It has been implicated in several pathological conditions, such as cancer progression and neurological disorders, making it a potential target for therapeutic interventions. Research on SEMA6B has focused on understanding its structure-function relationship, molecular mechanisms, and the signaling pathways it influences. The recombinant expression of SEMA6B allows for detailed studies of its interactions and effects in various cellular environments. By utilizing techniques such as protein purification, binding assays, and functional analyses, scientists aim to elucidate the role of SEMA6B in both normal physiology and disease states. This research holds promise for developing novel strategies to manipulate SEMA6B signaling in therapeutic applications, especially in the context of neurodevelopmental disorders and tumor biology, thereby contributing to a better understanding of complex biological systems.
