Cat: PA1000-7092

Recombinant Human NTRK1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NTRK1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NTRK1;MTC;TRK;TRKA;High affinity nerve growth factor receptor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P04629

  • Expression Region

    34-407aa

  • AA Sequence

    APCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIENQQHLQHLE LRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWK TVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPL AHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELE QSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVS FPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFL EPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMDNPF EFNPEDPIPVSFSPVDTNSTSGDP

  • Molecular Weight

    41 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NTRK1, part of the neurotrophic tyrosine receptor kinase family, plays a crucial role in neural development and cell signaling. It encodes a receptor for nerve growth factor (NGF), which is essential for the survival and differentiation of neurons. A significant area of research has focused on NTRK1 gene fusions and their association with various cancers, particularly in pediatric patients. These fusions result in the production of TRK fusion proteins, which exhibit constitutive activity, driving oncogenesis through unregulated cell proliferation and survival. The identification of these fusions has led to the exploration of targeted therapies, such as TRK inhibitors, which have shown promising results in treating tumors harboring NTRK fusions, including secretory breast cancer and pediatric sarcomas. Moreover, the study of NTRK1 has expanded into understanding its role in pain pathways and neurological disorders, highlighting its potential as a therapeutic target beyond oncology. Research is ongoing to elucidate the full spectrum of NTRK1's biological functions, its involvement in disease mechanisms, and the development of novel interventions that leverage its signaling pathways. As our understanding of NTRK1 and its associated pathways advances, it holds the promise of improving targeted treatment strategies for various malignancies and neurologic conditions, paving the way for personalized medicine approaches.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US