Analytical Data
-
Gene name
NTRK1
- Application
-
Alternative Names
NTRK1；MTC；TRK；TRKA；High affinity nerve growth factor receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P04629
-
Expression Region
34-407aa
-
AA Sequence
APCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIENQQHLQHLE LRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWK TVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPL AHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELE QSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVS FPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFL EPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMDNPF EFNPEDPIPVSFSPVDTNSTSGDP
-
Molecular Weight
41 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NTRK1, part of the neurotrophic tyrosine receptor kinase family, plays a crucial role in neural development and cell signaling. It encodes a receptor for nerve growth factor (NGF), which is essential for the survival and differentiation of neurons. A significant area of research has focused on NTRK1 gene fusions and their association with various cancers, particularly in pediatric patients. These fusions result in the production of TRK fusion proteins, which exhibit constitutive activity, driving oncogenesis through unregulated cell proliferation and survival. The identification of these fusions has led to the exploration of targeted therapies, such as TRK inhibitors, which have shown promising results in treating tumors harboring NTRK fusions, including secretory breast cancer and pediatric sarcomas. Moreover, the study of NTRK1 has expanded into understanding its role in pain pathways and neurological disorders, highlighting its potential as a therapeutic target beyond oncology. Research is ongoing to elucidate the full spectrum of NTRK1's biological functions, its involvement in disease mechanisms, and the development of novel interventions that leverage its signaling pathways. As our understanding of NTRK1 and its associated pathways advances, it holds the promise of improving targeted treatment strategies for various malignancies and neurologic conditions, paving the way for personalized medicine approaches.
