Cat: PA2000-3056

Recombinant Human MORC3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MORC3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MORC3;KIAA0136;NXP2;ZCWCC3;MORC family CW-type zinc finger Protein 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14149

  • Expression Region

    1-290aa

  • AA Sequence

    MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQI WIDKTVINDHICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLY GNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAF NKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWN LRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPESDYS LRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDVY

  • Molecular Weight

    49 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MORC3 (Microrchidia 3) is a member of the MORC protein family, which plays crucial roles in various biological processes, including gene regulation, DNA repair, and chromatin remodeling. Research has illuminated MORC3’s significance in cellular functions and its involvement in human diseases, particularly in cancer and immune responses. The protein's unique structural features and ATPase activity suggest its potential role in modulating chromatin states to influence gene expression. Recent studies have highlighted that MORC3 is not only essential for maintaining genomic integrity but also acts as a regulatory factor in the immune system by affecting the expression of pro-inflammatory genes. Consequently, understanding MORC3's molecular mechanisms and interactions has become a focus for researchers aiming to develop targeted therapies that leverage its biological functions. The exploration of MORC3's role in pathological conditions, especially in tumorigenesis and immune disorders, is increasingly relevant, as it may provide insights into novel therapeutic strategies and biomarkers for diagnosis and treatment. This growing body of evidence emphasizes the importance of recombinant MORC3 protein studies, not only to elucidate its fundamental biological roles but also to explore its potential as a target in medical research and therapeutic applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US