Analytical Data
-
Gene name
CD5L
- Application
-
Alternative Names
CD5L；API6；CD5 antigen-like
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43866
-
Expression Region
20-347aa
-
AA Sequence
MKHHHHHHASPSGVRLVGGLHRCEGRVEVEQKGQWGTVCDDGWDIKDVAV LCRELGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEE VYDCSHDEDAGASCENPESSFSPVPEGVRLADGPGHCKGRVEVKHQNQWY TVCQTGWSLRAAKVVCRQLGCGRAVLTQKRCNKHAYGRKPIWLSQMSCSG REATLQDCPSGPWGKNTCNHDEDTWVECEDPFDLRLVGGDNLCSGRLEVL HKGVWGSVCDDNWGEKEDQVVCKQLGCGKSLSPSFRDRKCYGPGVGRIWL DNVRCSGEEQSLEQCQHRFWGFHDCTHQEDVAVICSG
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD5L, also known as CD5 antigen-like protein, is an important protein implicated in various physiological and pathological processes, particularly in the immune system. It is primarily expressed in macrophages, dendritic cells, and other immune cells, playing crucial roles in modulating immune responses and maintaining homeostasis. Recent studies have shown that CD5L functions in diverse areas, such as lipid metabolism, inflammation, and apoptosis. In the context of autoimmune diseases and chronic inflammatory conditions, CD5L has garnered attention for its potential role in regulating the activation and survival of immune cells. Additionally, its involvement in the clearance of apoptotic cells highlights its importance in preventing autoimmunity and promoting tissue repair. As a result, researchers have been keen to explore the therapeutic potential of CD5L, considering its role in various diseases, including atherosclerosis, diabetes, and cancer. The development of recombinant CD5L protein for experimental and clinical applications is vital for understanding its mechanisms of action and potential as a biomarker or therapeutic target. By studying the structural and functional aspects of CD5L, researchers aim to elucidate its roles in immune regulation and disease progression, contributing to the advancement of targeted therapies for immune-mediated disorders. Overall, the exploration of CD5L as a recombinant protein presents opportunities to deepen our understanding of immune biology and develop novel strategies for disease intervention.
