Cat: PA1000-7015

Recombinant Human BST1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    BST1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    BST1;ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q10588

  • Expression Region

    33-293aa

  • AA Sequence

    RWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDP CSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDV LYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKD SSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGG PNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCAL KSAAAATQRKAHHHHHH

  • Molecular Weight

    31 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

BST-1 (Bone Marrow Stromal Antigen 1) is a type 2 transmembrane protein primarily expressed in hematopoietic and immune cells. It is a member of the NAD+-glycohydrolase family and acts as a key regulator in immune responses and calcium signaling. Research has shown that BST-1 plays a crucial role in the activation of monocytes and macrophages, promoting their function during immune responses. Additionally, its interaction with NAD+ and the subsequent production of cyclic ADP-ribose are pivotal for calcium mobilization, which is essential for various cellular processes, including proliferation, differentiation, and apoptosis. Dysregulation of BST-1 expression has been linked to several pathological conditions, such as chronic inflammation, autoimmune diseases, and certain cancers, highlighting its potential as a therapeutic target. The study of BST-1 recombinant proteins facilitates insights into its structural and functional properties, enabling the exploration of its role in immune regulation and its interactions with other signaling molecules. As researchers investigate the mechanisms of BST-1 in depth, understanding its contributions to immune system dynamics may pave the way for novel intervention strategies in diseases associated with immune dysregulation. Furthermore, the generation of BST-1 recombinant proteins can also aid in the development of diagnostic tools and therapies aimed at modulating immune responses for improved disease management. Overall, the study of BST-1 recombinant proteins offers significant promise in furthering our understanding of immune function and its implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US