Analytical Data
-
Gene name
BST1
- Application
-
Alternative Names
BST1；ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q10588
-
Expression Region
33-293aa
-
AA Sequence
RWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDP CSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDV LYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKD SSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGG PNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCAL KSAAAATQRKAHHHHHH
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BST-1 (Bone Marrow Stromal Antigen 1) is a type 2 transmembrane protein primarily expressed in hematopoietic and immune cells. It is a member of the NAD+-glycohydrolase family and acts as a key regulator in immune responses and calcium signaling. Research has shown that BST-1 plays a crucial role in the activation of monocytes and macrophages, promoting their function during immune responses. Additionally, its interaction with NAD+ and the subsequent production of cyclic ADP-ribose are pivotal for calcium mobilization, which is essential for various cellular processes, including proliferation, differentiation, and apoptosis. Dysregulation of BST-1 expression has been linked to several pathological conditions, such as chronic inflammation, autoimmune diseases, and certain cancers, highlighting its potential as a therapeutic target. The study of BST-1 recombinant proteins facilitates insights into its structural and functional properties, enabling the exploration of its role in immune regulation and its interactions with other signaling molecules. As researchers investigate the mechanisms of BST-1 in depth, understanding its contributions to immune system dynamics may pave the way for novel intervention strategies in diseases associated with immune dysregulation. Furthermore, the generation of BST-1 recombinant proteins can also aid in the development of diagnostic tools and therapies aimed at modulating immune responses for improved disease management. Overall, the study of BST-1 recombinant proteins offers significant promise in furthering our understanding of immune function and its implications in health and disease.
