Analytical Data
-
Gene name
MED1
- Application
-
Alternative Names
MED1；ARC205；CRSP1；CRSP200；Mediator of RNA polymerase II transcription subunit 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15648
-
Expression Region
878-1031aa
-
AA Sequence
FGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPF
-
Molecular Weight
32.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MED1, part of the mediator complex, plays a crucial role in the regulation of gene expression by serving as a bridge between transcription factors and the RNA polymerase II machinery. Recent studies have highlighted the significance of MED1 in various biological processes, including cell differentiation, development, and maintenance of stem cell pluripotency. Aberrant expression or function of MED1 has been linked to several diseases, particularly cancer, where it can influence tumor growth and metastasis through the regulation of key oncogenic pathways. Understanding the structure and function of MED1 at the molecular level can provide insights into its regulatory mechanisms and potential as a therapeutic target. Researchers have focused on the recombinant expression of MED1 protein to facilitate structural studies and functional assays, contributing to the elucidation of its role in mediating transcriptional responses. The development of MED1-based interventions holds promise for innovative therapeutic strategies aimed at modulating gene expression in disease contexts, underscoring the importance of continued research in this area.
