Analytical Data
-
Gene name
CIDEB
- Application
-
Alternative Names
Cell death activator CIDE B; Cell death activator CIDE-B; Cell death inducing DFFA like effector B ; Cell death-inducing DFFA-like effector B; CIDEB; CIDEB_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UHD4
-
Expression Region
1-219aa
-
AA Sequence
MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSLNVKATFYGLYSMSCDFQGLGPKKVLRELLRWTSTLLQGLGHMLLGISSTLRHAVEGAEQWQQKGRLHSY
-
Molecular Weight
49.83 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CIDEB (Candidate for Inducible Deletion of Epidermal Growth Factor Receptor Binding) is a member of the CIDE (Cell Death-Inducing DFFA-like Effector) family of proteins, which play significant roles in cellular processes, including apoptosis and lipid metabolism. Research on CIDEB has gained importance due to its involvement in the regulation of lipid droplet formation and storage, which is crucial for understanding obesity and metabolic disorders. It is predominantly expressed in liver and adipose tissues, where it contributes to triglyceride accumulation and energy homeostasis. Recent studies have linked CIDEB to various pathological conditions, including non-alcoholic fatty liver disease (NAFLD) and type 2 diabetes, thus highlighting its potential as a therapeutic target. Understanding the structure and function of CIDEB and its interactions with other proteins can provide insights into the molecular mechanisms underlying lipid metabolism and related diseases. The investigation of CIDEB’s role in cellular signaling pathways and its regulatory mechanisms offers a promising research avenue, with implications for developing novel strategies in tackling metabolic disorders. Therefore, the study of CIDEB is not only relevant for basic biological research but also holds therapeutic potential that could revolutionize approaches to managing metabolic diseases.
