Analytical Data
-
Gene name
CHX10
- Application
-
Alternative Names
Ceh 10 homeodomain containing homolog (C. elegans); Ceh-10 homeodomain-containing homolog; Ceh10 homeo domain containing homolog; Ceh10 homeodomain containing homolog; CHX 10; Homeobox protein CHX 10
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P58304
-
Expression Region
1-361aa
-
AA Sequence
MTGKAGEALSKPKSETVAKSTSGGAPARCTGFGIQEILGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRKKRRHRTIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESILKSAKDGIMDSCAPWLLGMHKKSLEAAAESGRKPEGERQALPKLDKMEQDERGPDAQAAISQEELRENSIAVLRAKAQEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAERLSPPQLEDMA
-
Molecular Weight
65.8 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CHX10, also known as encoded by the gene PRDM13, is a critical transcription factor predominantly expressed during the development of the retina and the central nervous system. Its role in regulating neuronal differentiation and retinal development has garnered significant interest in recent years. Dysregulation of CHX10 expression has been linked to various retinal disorders, including retinitis pigmentosa and glaucoma, highlighting its potential as a therapeutic target. Research has focused on the characterization of CHX10 recombinant protein to elucidate its functional mechanisms in cellular context. The study of this protein aids in understanding the pathways involved in retinal neurogenesis and the maintenance of retinal progenitor cells. Advances in protein expression technologies, such as recombinant DNA techniques, have facilitated the production of CHX10 in various systems, enabling in-depth biochemical and functional analyses. By investigating the protein's interactions and regulatory networks, researchers aim to uncover its precise role in retinal biology, which may lead to novel strategies for the treatment of retinal diseases and other neurodevelopmental disorders. Thus, the research surrounding CHX10 recombinant protein is not only pivotal for basic biology but also holds promise for translational applications in ophthalmology and regenerative medicine.
