Analytical Data
-
Gene name
CHST4
- Application
-
Alternative Names
CHST4Carbohydrate sulfotransferase 4; EC 2.8.2.-; Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 3; GST-3; High endothelial cells N-acetylglucosamine 6-O-sulfotransferase; HEC-GlcNAc6S
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NCG5
-
Expression Region
1-370aa
-
AA Sequence
MAILALFFHMYSHNISSLSMKAQPERMHVLVLSSWRSGSSFVGQLFGQHPDVFYLMEPAWHVWMTFKQSTAWMLHMAVRDLIRAVFLCDMSVFDAYMEPGPRRQSSLFQWENSRALCSAPACDIIPQDEIIPRAHCRLLCSQQPFEVVEKACRSYSHVVLKEVRFFNLQSLYPLLKDPSLNLHIVHLVRDPRAVFRSRERTKGDLMIDSRIVMGQHEQKLKKEDQPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLARAPVAQTSRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAFHTNARDALNVSQAWRWSLPYEKVSRLQKACGDAMNLLGYRHVRSEQEQRNLLLDLLSTWTVPEQIH
-
Molecular Weight
66.44 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CHST4 (Carbohydrate Sulfotransferase 4) is a crucial enzyme involved in the sulfation of carbohydrates, playing a significant role in the biosynthesis of glycosaminoglycans (GAGs) and other sulfated glycan structures. These sulfated carbohydrates are essential for various biological processes, including cell signaling, proliferation, and modulation of extracellular matrix components. Dysregulation of CHST4 has been implicated in multiple pathological conditions, including cancer metastasis and developmental disorders. Given its importance, researchers have focused on reconstructing CHST4 as a recombinant protein to elucidate its structure-function relationship and to understand its enzymatic mechanisms in greater detail. By producing CHST4 in a heterologous expression system, scientists aim to obtain sufficient quantities of the protein for biochemical assays and structural studies. This research not only provides insights into the enzyme's role in cellular processes but also holds potential for therapeutic applications, such as targeting CHST4 for the development of drugs that can modulate sulfation patterns, which could impact disease outcomes. Overall, the study of CHST4 recombinant protein serves as a pivotal step towards unraveling the complexities of carbohydrate sulfation and its implications in health and disease.
