Cat: PA1000-6956

Recombinant Human ADAMTSL1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ADAMTSL1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ADAMTSL1;ADAMTSR1;C9orf94;ADAMTS-like Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8N6G6

  • Expression Region

    1-439aa

  • AA Sequence

    MECCRRATPGTLLLFLAFLLLSSRTARSEEDRDGLWDAWGPWSECSRTCG GGASYSLRRCLSSKSCEGRNIRYRTCSNVDCPPEAGDFRAQQCSAHNDVK HHGQFYEWLPVSNDPDNPCSLKCQAKGTTLVVELAPKVLDGTRCYTESLD MCISGLCQIVGCDHQLGSTVKEDNCGVCNGDGSTCRLVRGQYKSQLSATK SDDTVVAIPYGSRHIRLVLKGPDHLYLETKTLQGTKGENSLSSTGTFLVD NSSVDFQKFPDKEILRMAGPLTADFIVKIRNSGSADSTVQFIFYQPIIHR WRETDFFPCSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENIKPKPK LQECNLDPCPARWEATPWTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEE WKCMYTPKMPIAQPCNIFDCPKWLAQEWSPVTVPSFFVH

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ADAMTSL1 (A Disintegrin and Metalloproteinase with Thrombospondin Motifs 1) is a recently identified protein that plays crucial roles in various biological processes, particularly in the regulation of extracellular matrix (ECM) dynamics and cell signaling. Its structure is characterized by multiple thrombospondin-like motifs, which suggest a function in mediating interactions between cells and the ECM. Research has shown that ADAMTSL1 is involved in processes such as angiogenesis, tissue repair, and development; however, its precise mechanisms and pathways remain largely unexplored. Notably, ADAMTSL1 has been linked to several pathological conditions, including vascular diseases and certain types of cancer, indicating its potential as a biomarker or therapeutic target. The recombinant production of ADAMTSL1 is essential for detailed functional studies, as well as for investigating its roles in health and disease. Advances in recombinant protein technology have made it feasible to produce ADAMTSL1 in sufficient quantities for biological assays and biochemical characterization. Understanding the structure-function relationship of ADAMTSL1 through recombinant studies may provide insights into its involvement in ECM remodeling and its implications in disease progression. Consequently, ongoing research aims to elucidate the biological significance of ADAMTSL1 and capitalize on its therapeutic potential, making it a promising subject in both fundamental and applied biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US