Cat: PA2000-6689

Recombinant Human CHST1 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CHST1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CHST1; Carbohydrate sulfotransferase 1; Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 1; GST-1; Keratan sulfate Gal-6 sulfotransferase; KS6ST; KSGal6ST; KSST

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O43916

  • Expression Region

    168-267aa

  • AA Sequence

    PPGPADLVLEEGDCVRKCGLLNLTVAAEACRERSHVAIKTVRVPEVNDLRALVEDPRLNLKVIQLVRDPRGILASRSETFRDTYRLWRLWYGTGRKPYNL

  • Molecular Weight

    36.74 KDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CHST1, or carbohydrate sulfotransferase 1, is an enzyme that plays a crucial role in the sulfation of glycosaminoglycans (GAGs), particularly in the biosynthesis of heparan sulfate. This process is essential for various biological functions, including cell signaling, development, and tissue repair. Abnormalities in CHST1 activity have been linked to several diseases, including certain types of cancer and developmental disorders, underscoring the enzyme's significance in health and disease. The recombinant expression of CHST1 has become a focal point in biochemical research, as it allows for the detailed study of the enzyme’s structure-function relationships and its interactions with substrates. Furthermore, the availability of recombinant CHST1 enables the exploration of potential therapeutic approaches to modulate its activity, aiming to correct sulfation defects or to engineer novel glycosaminoglycan-based therapeutics. In this context, studies on CHST1 not only enhance our understanding of glycosylation processes but also offer insights into the therapeutic benefits of targeting sulfation pathways in various diseases. Exploring the biochemical properties and functional implications of CHST1 through recombinant techniques can pave the way for innovative strategies in regenerative medicine and targeted therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US