Cat: PA2000-3039

Recombinant Human AIMP2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AIMP2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AIMP2;JTV1;Aminoacyl tRNA synthase complex-interacting multifunctional Protein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q13155

  • Expression Region

    1-320aa

  • AA Sequence

    MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK

  • Molecular Weight

    39.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AIMP2, also known as Aminoacyl-tRNA Synthetase Interacting Multifunctional Protein 2, is a crucial component of the multi-aminoacyl-tRNA synthetase complex that plays a vital role in protein synthesis and cellular homeostasis. Research into AIMP2 has gained significant attention due to its involvement in various physiological processes, including cell proliferation, differentiation, and apoptosis. Studies have indicated that AIMP2 functions beyond its role in tRNA processing, acting as a signaling molecule that influences oncogenic pathways, thus linking it to cancer biology. The investigation of AIMP2's structure and its interactions with other proteins is essential for understanding its multifunctional roles and their implications in diseases. In the context of disease states, particularly cancer, aberrant expression of AIMP2 has been associated with tumor progression and poorer patient outcomes. As a result, AIMP2 is being explored as a potential biomarker for cancer diagnosis and prognosis, as well as a target for therapeutic intervention. Recent advances in recombinant protein technology have enabled the production of AIMP2 in a controlled environment, facilitating detailed biochemical and structural studies. This research is pivotal for unraveling the molecular mechanisms underlying AIMP2's diverse functions and could lead to novel strategies for cancer treatment and management. The collective efforts in AIMP2 research underscore its importance in both basic biology and clinical therapeutics, positioning it as a significant focus in the field of molecular biology and oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US