Analytical Data
-
Gene name
AIMP2
- Application
-
Alternative Names
AIMP2；JTV1；Aminoacyl tRNA synthase complex-interacting multifunctional Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13155
-
Expression Region
1-320aa
-
AA Sequence
MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK
-
Molecular Weight
39.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AIMP2, also known as Aminoacyl-tRNA Synthetase Interacting Multifunctional Protein 2, is a crucial component of the multi-aminoacyl-tRNA synthetase complex that plays a vital role in protein synthesis and cellular homeostasis. Research into AIMP2 has gained significant attention due to its involvement in various physiological processes, including cell proliferation, differentiation, and apoptosis. Studies have indicated that AIMP2 functions beyond its role in tRNA processing, acting as a signaling molecule that influences oncogenic pathways, thus linking it to cancer biology. The investigation of AIMP2's structure and its interactions with other proteins is essential for understanding its multifunctional roles and their implications in diseases. In the context of disease states, particularly cancer, aberrant expression of AIMP2 has been associated with tumor progression and poorer patient outcomes. As a result, AIMP2 is being explored as a potential biomarker for cancer diagnosis and prognosis, as well as a target for therapeutic intervention. Recent advances in recombinant protein technology have enabled the production of AIMP2 in a controlled environment, facilitating detailed biochemical and structural studies. This research is pivotal for unraveling the molecular mechanisms underlying AIMP2's diverse functions and could lead to novel strategies for cancer treatment and management. The collective efforts in AIMP2 research underscore its importance in both basic biology and clinical therapeutics, positioning it as a significant focus in the field of molecular biology and oncology.
