Analytical Data
-
Gene name
SCTR
- Application
-
Alternative Names
SCT-R
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P47872
-
Expression Region
23-440 aa
-
AA Sequence
HSTGALPRLCDVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLLKLKVMYTVGYSSSLVMLLVALGILCAFRRLHCTRNYIHMHLFVSFILRALSNFIKDAVLFSSDDVTYCDAHRAGCKLVMVLFQYCIMANYSWLLVEGLYLHTLLAISFFSERKYLQGFVAFGWGSPAIFVALWAIARHFLEDVGCWDINANASIWWIIRGPVILSILINFILFINILRILMRKLRTQETRGNEVSHYKRLARSTLLLIPLFGIHYIVFAFSPEDAMEIQLFFELALGSFQGLVVAVLYCFLNGEVQLEVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII
-
Molecular Weight
53.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SCTR, or Secretin Receptor, is a G protein-coupled receptor that plays a crucial role in various physiological processes, including the regulation of pancreatic secretion and gastrointestinal motility. Research into SCTR and its recombinant proteins has gained traction due to its potential implications in treating gastrointestinal disorders and metabolic diseases. The receptor is primarily activated by secretin, a peptide hormone that stimulates the secretion of bicarbonate-rich pancreatic fluid, thereby aiding in digestion and maintaining the acid-base balance in the intestine. Given its significance, understanding the structure, function, and signaling pathways associated with SCTR is essential for developing therapeutic agents. Advances in recombinant protein technology allow for the production of SCTR in a more controlled and efficient manner, facilitating in-depth studies of its binding properties, conformational changes, and interaction with downstream signaling molecules. Furthermore, investigating the recombinant forms of SCTR can provide insights into its potential role in disease states, such as diabetes and obesity, where its signaling may be disrupted. Consequently, the exploration of SCTR through recombinant proteins not only enhances our biochemical understanding but also opens avenues for therapeutic innovations in managing related health conditions.











