Cat: PA1000-6920

Recombinant Human XIAP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    XIAP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    XIAP;API3;BIRC4;IAP3;E3 ubiquitin-Protein ligase XIAP

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P98170

  • Expression Region

    120-356aa

  • AA Sequence

    MHHHHHHYLGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYS EEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEP CDRAWSEHRRHFPNCFFVLGRNLNIRSESDAVSSDRNFPNSTNLPRNPSM ADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKP SEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT

  • Molecular Weight

    28 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

XIAP (X-linked inhibitor of apoptosis protein) is a member of the IAP (inhibitor of apoptosis protein) family, known for its critical role in regulating apoptosis and promoting cell survival. Research on XIAP has gained significant momentum due to its implications in various diseases, particularly cancer. Elevated levels of XIAP are often observed in several malignancies, where it contributes to the resistance of cancer cells to apoptosis, thus complicating treatment strategies. The understanding of XIAP's functional mechanisms has prompted extensive studies into its structure and interactions, highlighting its potential as a therapeutic target. Recombinant XIAP proteins serve as essential tools for these investigations, allowing scientists to explore the protein's specific interactions with other cellular components and its involvement in signaling pathways that govern cell fate. The development and characterization of recombinant XIAP proteins not only facilitate the deciphering of its biological functions but also pave the way for novel therapeutic approaches aimed at enhancing apoptosis in cancer cells, potentially overcoming drug resistance. As research progresses, elucidating the role of XIAP in both normal and pathological processes is expected to yield significant insights, contributing to the development of targeted therapies that can effectively combat cancers associated with XIAP dysregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US