Analytical Data
-
Gene name
XIAP
- Application
-
Alternative Names
XIAP；API3；BIRC4；IAP3；E3 ubiquitin-Protein ligase XIAP
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P98170
-
Expression Region
120-356aa
-
AA Sequence
MHHHHHHYLGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYS EEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEP CDRAWSEHRRHFPNCFFVLGRNLNIRSESDAVSSDRNFPNSTNLPRNPSM ADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKP SEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
XIAP (X-linked inhibitor of apoptosis protein) is a member of the IAP (inhibitor of apoptosis protein) family, known for its critical role in regulating apoptosis and promoting cell survival. Research on XIAP has gained significant momentum due to its implications in various diseases, particularly cancer. Elevated levels of XIAP are often observed in several malignancies, where it contributes to the resistance of cancer cells to apoptosis, thus complicating treatment strategies. The understanding of XIAP's functional mechanisms has prompted extensive studies into its structure and interactions, highlighting its potential as a therapeutic target. Recombinant XIAP proteins serve as essential tools for these investigations, allowing scientists to explore the protein's specific interactions with other cellular components and its involvement in signaling pathways that govern cell fate. The development and characterization of recombinant XIAP proteins not only facilitate the deciphering of its biological functions but also pave the way for novel therapeutic approaches aimed at enhancing apoptosis in cancer cells, potentially overcoming drug resistance. As research progresses, elucidating the role of XIAP in both normal and pathological processes is expected to yield significant insights, contributing to the development of targeted therapies that can effectively combat cancers associated with XIAP dysregulation.
