Analytical Data
-
Gene name
MBTPS1
- Application
-
Alternative Names
MBTPS1；KIAA0091；S1P；SKI1；Membrane-bound transcription factor site-1 protease
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14703
-
Expression Region
187-400aa
-
AA Sequence
RAIPRQVAQTLQADVLWQMGYTGANVRVAVFDTGLSEKHPHFKNVKERTNWTNERTLDDGLGHGTFVAGVIASMRECQGFAPDAELHIFRVFTNNQVSYTSWFLDAFNYAILKKIDVLNLSIGGPDFMDHPFVDKVWELTANNVIMVSAIGNDGPLYGTLNNPADQMDVIGVGGIDFEDNIARFSSRGMTTWELPGGYGRMKPDIVTYGAGVRG
-
Molecular Weight
27.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MBTPS1 (Membrane-Bound Transcription Factor Peptidase Site 1) is a crucial component of the regulated intramembrane proteolysis (RIP) pathway, which plays a significant role in the cellular response to stress and homeostasis. This enzyme is responsible for cleaving substrates such as sterol regulatory element-binding proteins (SREBPs), which are essential in the regulation of lipid metabolism and cellular cholesterol homeostasis. Recent studies have highlighted the importance of MBTPS1 in various diseases, including metabolic disorders, neurodegenerative diseases, and certain cancers, as it mediates the activation of signaling pathways involved in cell survival and apoptosis. Furthermore, dysregulation of MBTPS1 is linked to impaired lipid metabolism and increased susceptibility to lipid-related diseases. Researchers are increasingly focused on the structure, function, and regulatory mechanisms of MBTPS1, aiming to develop targeted therapies that can modulate its activity. By understanding the molecular intricacies of MBTPS1, scientists hope to unveil novel strategies for treating conditions associated with lipid dysregulation and other related pathologies, making it a pivotal target in biomedical research.
