Analytical Data
-
Gene name
CHD9
- Application
-
Alternative Names
CHD9; KIAA0308; KISH2; PRIC320; AD-013; x0008Chromodomain-helicase-DNA-binding Protein 9; CHD-9; EC 3.6.4.12; ATP-dependent helicase CHD9
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q3L8U1
-
Expression Region
1-119
-
AA Sequence
MLINLLVAQLNMCYLHTLSLIVLQSIPKTNPMVCFQMYQMAVQCGAIRQLLPFQIKMDLLFTNKDIHTLCIKIKALWHTMTLPYFRPMNNKHSVLHYAHNKTEIISTQGRILLASLKIL
-
Molecular Weight
38.83 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CHD9, a member of the chromodomain helicase DNA-binding (CHD) protein family, plays a critical role in chromatin remodeling and gene regulation. Its involvement in various cellular processes makes it a significant focus of research. Studies have shown that CHD9 is essential for maintaining cellular homeostasis and influencing developmental pathways. Dysregulation or mutations in CHD9 have been associated with several diseases, including cancer and autoimmune disorders, highlighting its potential as a therapeutic target. Recombination and characterization of CHD9 protein have provided insights into its functional domains and interaction partners, thereby elucidating its mechanisms of action within the nucleus. Researchers aim to understand CHD9’s role in chromatin organization, transcriptional regulation, and its response to environmental cues, as well as its impact on cellular stress responses. Through recombinant protein technology, scientists are investigating CHD9's biochemical properties and its interactions with histones and other chromatin-associated proteins. This research not only furthers our understanding of epigenetic regulation but also opens avenues for developing novel therapeutic strategies that leverage the manipulation of CHD9 activity in various diseases.
