Cat: PAX2000-11137

Recombinant Human SBNO1 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SBNO1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FLJ10701; FLJ10833; FLJ16176; Monocyte protein 3; MOP 3 ; MOP-3; MOP3; Protein strawberry notch homolog 1; SBNO 1; Sbno1; SBNO1_HUMAN; Sno; Sno strawberry notch homolog 1; Strawberry notch homolog 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    A3KN83

  • Expression Region

    1-181 aa

  • AA Sequence

    MEVHQQNALFQYFADTLTAVVQNAKKNGRYDMGILDLGSGDEKVRKSDVKKFLTPGYSTSGHVELYTISVERGMSWEEATKIWAELTGPDDGFYLSLQIRNNKKTAILVKEVNPKKKLFLVYRPNTGKQLKLEIYADLKKKYKKVFFHLYIILYRNTYFGPGNVAHTCNLSTLGGRGGQIT

  • Molecular Weight

    47 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of SBNO1 (Strawberry Notch 1) recombinant protein has gained significant interest due to its potential roles in cellular signaling and developmental processes. Identified as a crucial component of the Wnt signaling pathway, SBNO1 is implicated in embryonic development and tissue homeostasis. Its expression has been linked to various physiological and pathological conditions, including cancer progression and neurodevelopmental disorders. The functional characterization of SBNO1 remains challenging due to the complexity of its interactions with other proteins and cellular components. By generating recombinant SBNO1, researchers aim to elucidate its biochemical properties and functional mechanisms. This involves the expression and purification of the protein to enable in-depth studies, including structural analysis and interaction assays. Understanding SBNO1’s function could provide insights into the modulation of cell signaling pathways, offering potential therapeutic targets for diseases. The ongoing research emphasizes the importance of SBNO1 in cellular regulation and its relevance in both basic and applied biomedical sciences.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US