Analytical Data
-
Gene name
CG018
- Application
-
Alternative Names
CG018; hypothetical gene CG018; N42L1_HUMAN; N4BP2L1; NEDD4-binding Protein 2-like 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5TBK1
-
Expression Region
1-173aa
-
AA Sequence
MEDSFLQSFGRLSLQPQQQQQRQRPPRPPPRGTPPRRHSFRKHLYLLRGLPGSGKTTLARQLQHDFPRALIFSTDDFFFREDGAYEFNPDFLEEAHEWNQKRARKAMRNGISPIIIDNTNLHAWEMKPYAVMVFQTEQKNLFRLEMDMVVFRPEMKKHSWCLKRKNPPNERTV
-
Molecular Weight
47.1 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CG018 recombinant protein has garnered significant attention in recent years due to its potential applications in various fields, including therapeutics and biotechnology. Initially discovered in a specific cell line, CG018 has been associated with critical biological processes such as cell signaling, immune response modulation, and metabolic regulation. Researchers have identified its role in disease mechanisms, particularly in cancer and autoimmune disorders, where aberrant expression of similar proteins has been documented. The recombinant expression of CG018 allows for detailed studies into its structure, function, and interactions with other biomolecules, facilitating the development of assays that can screen for small-molecule inhibitors or therapeutic agents. Advances in recombinant DNA technology have enabled the efficient production of this protein, providing a means to explore its therapeutic potential and diagnostic utility. Furthermore, the study of CG018 contributes to the broader understanding of protein engineering, offering insights into designing proteins with customized functions for specific medical applications. As research continues to unveil the complexities surrounding CG018, its promise as a target for drug development and as a tool for advancing molecular biology remains a focal point in contemporary biomedical research.
