Analytical Data
-
Gene name
MICB
- Application
-
Alternative Names
MICB；PERB11.2；MHC class I polypeptide-related sequence B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q29980
-
Expression Region
23-309aa
-
AA Sequence
AEPHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQGQW AENVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCEIH EDSSTRGSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKED AMKTKTHYRAMQADCLQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNIT VTCRASSFYPRNITLTWRQDGVSLSHNTQQWGDVLPDGNGTYQTWVATRI RQGEEQRFTCYMEHSGNHGTHPVPSGKALVLQSQRTD
-
Molecular Weight
34 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MICB (MHC class I polypeptide-related sequence B) is an important protein involved in the immune response, particularly in the recognition and elimination of stressed or infected cells by cytotoxic T lymphocytes (CTLs). It belongs to the MHC class I family but is unique in that it is not involved in presenting conventional peptide antigens to T cells. Instead, MICB acts as a stress ligand, binding to NKG2D receptors on CTLs and natural killer (NK) cells, thus triggering an immune response against tumor or virally infected cells. Given its critical role in immune surveillance and potential involvement in various diseases, including cancer and viral infections, researchers have focused on the production and characterization of recombinant MICB protein. This recombinant protein can be utilized in various applications, including immunotherapy, where enhancing the immune response against tumors is desired. The study of recombinant MICB also extends to understanding its structural properties, interaction dynamics with immune receptors, and its potential as a biomarker for disease progression. Significant advancements in molecular cloning, protein expression, and purification techniques have facilitated the development of high-quality MICB protein, paving the way for both basic research and therapeutic innovations in immunology. As the scientific community continues to explore the functions and applications of MICB, it holds promise for novel strategies in combating cancers and infectious diseases, making it a focal point of ongoing immunological research.
